AibGenesis™ Mouse Anti-MRPS12 Antibody (CBMOAB-02426CR)


Cat: CBMOAB-02426CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02426CR Monoclonal Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO02426CR 100 µg
CBMOAB-06841HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO06841HB 100 µg
MO-AB-05316H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05316C 100 µg
MO-AB-16042R Monoclonal Cattle (Bos taurus) WB, ELISA MO16042R 100 µg
MO-AB-25066W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25066W 100 µg
MO-AB-27226H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27226C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO02426CR
SpecificityThis antibody binds to Yeast MRPS12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5' UTR have been found for this gene; all three variants encode the same protein. (From NCBI)
Product OverviewMouse Anti-Yeast MRPS12 Antibody is a mouse antibody against MRPS12. It can be used for MRPS12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names37S ribosomal protein S12, mitochondrial; MRPS12; YNR036C
UniProt IDP53732
Protein RefseqThe length of the protein is 153 amino acids long. The sequence is show below: MLSRFMSNTWCTPLRQAQRLFSSTTTMQATLNQIKRGSGPPRRKKISTAPQLDQCPQRKGVVLRVMVLKPKKPNSAQRKACRVRLTNGNVVSAYIPGEGHDAQEHSIVYVRGGRCQDLPGVKYHVIRGAGDLSGVVNRISSRSKYGAKKPSKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry