AibGenesis™ Mouse Anti-MRPS33 Antibody (CBMOAB-06859HCB)
Cat: CBMOAB-06859HCB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-06859HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO06859HB | 100 µg | ||
| CBMOAB-24775FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO24775FYA | 100 µg | ||
| CBMOAB-87465FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87465FYA | 100 µg | ||
| MO-AB-05326H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05326C | 100 µg | ||
| MO-AB-12111Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO12111Y | 100 µg | ||
| MO-AB-16068R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16068R | 100 µg | ||
| MO-AB-24701W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24701W | 100 µg | ||
| MO-AB-27240H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27240C | 100 µg | ||
| MO-AB-35148W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35148W | 100 µg | ||
| MO-AB-59400W | Monoclonal | Marmoset | WB, ELISA | MO59400W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO06859HB |
| Specificity | This antibody binds to C. elegans MRPS33. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. The 28S subunit of the mammalian mitoribosome may play a crucial and characteristic role in translation initiation. This gene encodes a 28S subunit protein that is one of the more highly conserved mitochondrial ribosomal proteins among mammals, Drosophila and C. elegans. Splice variants that differ in the 5' UTR have been found for this gene; all variants encode the same protein. Pseudogenes corresponding to this gene are found on chromosomes 1q, 4p, 4q, and 20q. (From NCBI) |
| Product Overview | Mouse Anti-C. elegans MRPS33 Antibody is a mouse antibody against MRPS33. It can be used for MRPS33 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein MRPS-33; mrps-33 |
| UniProt ID | Q19685 |
| Protein Refseq | The length of the protein is 126 amino acids long. The sequence is show below: MAARLAASRIVHAGRGISQPTPFGKRMDRLSNRVWGEVVMPTDTKSLKVVRVMSAEPYETKEQLSPKYYPNLPMFHYLTKMLRFHGLFFDDHVVFRDVQDNLKIIRGKVVRPPIGQGKRAQLRGKK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry