AibGenesis™ Mouse Anti-MRPS33 Antibody (CBMOAB-06859HCB)


Cat: CBMOAB-06859HCB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06859HCB Monoclonal C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO06859HB 100 µg
CBMOAB-24775FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO24775FYA 100 µg
CBMOAB-87465FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87465FYA 100 µg
MO-AB-05326H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05326C 100 µg
MO-AB-12111Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12111Y 100 µg
MO-AB-16068R Monoclonal Cattle (Bos taurus) WB, ELISA MO16068R 100 µg
MO-AB-24701W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24701W 100 µg
MO-AB-27240H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27240C 100 µg
MO-AB-35148W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35148W 100 µg
MO-AB-59400W Monoclonal Marmoset WB, ELISA MO59400W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO06859HB
SpecificityThis antibody binds to C. elegans MRPS33.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. The 28S subunit of the mammalian mitoribosome may play a crucial and characteristic role in translation initiation. This gene encodes a 28S subunit protein that is one of the more highly conserved mitochondrial ribosomal proteins among mammals, Drosophila and C. elegans. Splice variants that differ in the 5' UTR have been found for this gene; all variants encode the same protein. Pseudogenes corresponding to this gene are found on chromosomes 1q, 4p, 4q, and 20q. (From NCBI)
Product OverviewMouse Anti-C. elegans MRPS33 Antibody is a mouse antibody against MRPS33. It can be used for MRPS33 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein MRPS-33; mrps-33
UniProt IDQ19685
Protein RefseqThe length of the protein is 126 amino acids long. The sequence is show below: MAARLAASRIVHAGRGISQPTPFGKRMDRLSNRVWGEVVMPTDTKSLKVVRVMSAEPYETKEQLSPKYYPNLPMFHYLTKMLRFHGLFFDDHVVFRDVQDNLKIIRGKVVRPPIGQGKRAQLRGKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry