AibGenesis™ Mouse Anti-MRPS36 Antibody (CBMOAB-51776FYA)


Cat: CBMOAB-51776FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51776FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO51776FYA 100 µg
MO-AB-05329H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05329C 100 µg
MO-AB-16072R Monoclonal Cattle (Bos taurus) WB, ELISA MO16072R 100 µg
MO-AB-20556W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20556W 100 µg
MO-AB-27242H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27242C 100 µg
MO-AB-59406W Monoclonal Marmoset WB, ELISA MO59406W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO51776FYA
SpecificityThis antibody binds to Rhesus MRPS36.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. The mitochondrial ribosome (mitoribosome) consists of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 3p, 4q, 8p, 11q, 12q, and 20p. (From NCBI)
Product OverviewMouse Anti-Rhesus MRPS36 Antibody is a mouse antibody against MRPS36. It can be used for MRPS36 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMRPS36
UniProt IDF7F3N1
Protein RefseqThe length of the protein is 103 amino acids long.
The sequence is show below: MMGSKMASASRVVQVVKPHTPLIRFPDRRDNRKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQDPPDTAEIIKTLPQKYRRKLVSQEEIEFIQRGGPE.
For Research Use Only | Not For Clinical Use.
Online Inquiry