AibGenesis™ Mouse Anti-MSRB5 Antibody (CBMOAB-34732FYB)


Cat: CBMOAB-34732FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34732FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO34732FYB 100 µg
Inquiry
CBMOAB-36764FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO36764FC 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO34732FYB
SpecificityThis antibody binds to Rice MSRB5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRB family specifically reduces the MetSO R-enantiomer. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice MSRB5 Antibody is a mouse antibody against MSRB5. It can be used for MSRB5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPeptide methionine sulfoxide reductase B5; OsMSRB5; EC 1.8.4.12; Peptide-methionine (R)-S-oxide reductase; MSRB5; Os03g0360700 LOC_Os03g24600
UniProt IDQ10L32
Protein RefseqThe length of the protein is 136 amino acids long.
The sequence is show below: MASSGDSSGKQRSDEEWRAVLSPEQFRILRLKGTELPGTGEYNKFYGDGVYNCAGCGTPLYKSTTKFDSGCGWPAFFEGLPGAINRTPDPDGRRVEITCAACGGHLGHVFKGEGFKTPTDERHCVNSVSIKFTPAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry