AibGenesis™ Mouse Anti-Mstn Antibody (MO-AB-13931Y)


Cat: MO-AB-13931Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13931Y Monoclonal Sea-anemone, Bovine, Human, Mouse, Rat, Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO13931Y 100 µg
MO-AB-31832W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31832W 100 µg
MO-AB-37709W Monoclonal Goat (Capra hircus) WB, ELISA MO37709W 100 µg
MO-AB-45566W Monoclonal Horse (Equus caballus) WB, ELISA MO45566W 100 µg
MO-AB-16111R Monoclonal Cattle (Bos taurus) WB, ELISA MO16111R 100 µg
MO-AB-00936R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00936R 100 µg
MO-AB-27377R Monoclonal Pig (Sus scrofa) WB, ELISA MO27377R 100 µg
MO-AB-23450H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23450C 100 µg
MO-AB-02968Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02968Y 100 µg
MO-AB-08868Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08868Y 100 µg
MO-AB-16190Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16190Y 100 µg
MOFY-0722-FY362 Polyclonal Bovine, Human, Mouse, Rat WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySea-anemone, Bovine, Human, Mouse, Rat, Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO13931Y
SpecificityThis antibody binds to Sea-anemone Mstn.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein negatively regulates skeletal muscle cell proliferation and differentiation. Mutations in this gene are associated with increased skeletal muscle mass in humans and other mammals. [provided by RefSeq, Jul 2016] (From NCBI)
Product OverviewThis product is a mouse antibody against Mstn. It can be used for Mstn detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyostatin; mstn
UniProt IDR4SCY7
Protein RefseqThe length of the protein is 350 amino acids long. The sequence is show below: MFLTPTLFIAFLALCECSRCPLCADPMENLKQDRLQAIQQQILDKLGLPFAPNLTDPKIPNIPPLLRLLETSRNAELAASRVKHEDNYHAKTKTIIMFPEKAPTIIREHSAKCCFFQFREKASRLRISKATLDVFVKRNPNASSTNRDPQIKLYKRVFPVTEGIPEKELVTTKPIRPGQSGWYHFKVKKLLREWRREPHKNLGVEFEIEGNDGSLSLVTEGNEAKKPFLEVFTHDTGNKRRAKRRAGLDCDPYSHERRCCRYELTVDFEKFSWNWIIAPKRFRAYYCTGECQEIMLPMYPHAHMVKKSTGKRPCCSPTKMSSISMIYFDFNQQIMFEEVPAMVAETCGCT.
For Research Use Only | Not For Clinical Use.
Online Inquiry