AibGenesis™ Mouse Anti-Mstn Antibody (MO-AB-13931Y)
Cat: MO-AB-13931Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-13931Y | Monoclonal | Sea-anemone, Bovine, Human, Mouse, Rat, Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO13931Y | 100 µg | ||
| MO-AB-31832W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31832W | 100 µg | ||
| MO-AB-37709W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37709W | 100 µg | ||
| MO-AB-45566W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45566W | 100 µg | ||
| MO-AB-16111R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16111R | 100 µg | ||
| MO-AB-00936R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00936R | 100 µg | ||
| MO-AB-27377R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27377R | 100 µg | ||
| MO-AB-23450H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23450C | 100 µg | ||
| MO-AB-02968Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02968Y | 100 µg | ||
| MO-AB-08868Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08868Y | 100 µg | ||
| MO-AB-16190Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO16190Y | 100 µg | ||
| MOFY-0722-FY362 | Polyclonal | Bovine, Human, Mouse, Rat | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Sea-anemone, Bovine, Human, Mouse, Rat, Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
| Clone | MO13931Y |
| Specificity | This antibody binds to Sea-anemone Mstn. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein negatively regulates skeletal muscle cell proliferation and differentiation. Mutations in this gene are associated with increased skeletal muscle mass in humans and other mammals. [provided by RefSeq, Jul 2016] (From NCBI) |
| Product Overview | This product is a mouse antibody against Mstn. It can be used for Mstn detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Myostatin; mstn |
| UniProt ID | R4SCY7 |
| Protein Refseq | The length of the protein is 350 amino acids long. The sequence is show below: MFLTPTLFIAFLALCECSRCPLCADPMENLKQDRLQAIQQQILDKLGLPFAPNLTDPKIPNIPPLLRLLETSRNAELAASRVKHEDNYHAKTKTIIMFPEKAPTIIREHSAKCCFFQFREKASRLRISKATLDVFVKRNPNASSTNRDPQIKLYKRVFPVTEGIPEKELVTTKPIRPGQSGWYHFKVKKLLREWRREPHKNLGVEFEIEGNDGSLSLVTEGNEAKKPFLEVFTHDTGNKRRAKRRAGLDCDPYSHERRCCRYELTVDFEKFSWNWIIAPKRFRAYYCTGECQEIMLPMYPHAHMVKKSTGKRPCCSPTKMSSISMIYFDFNQQIMFEEVPAMVAETCGCT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry