AibGenesis™ Mouse Anti-mtfp1 Antibody (CBMOAB-87665FYA)


Cat: CBMOAB-87665FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87665FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO87665FYA 100 µg
MO-AB-04496W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04496W 100 µg
MO-AB-05364H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05364C 100 µg
MO-AB-16151R Monoclonal Cattle (Bos taurus) WB, ELISA MO16151R 100 µg
MO-AB-23559W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23559W 100 µg
MO-AB-27287H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27287C 100 µg
MO-AB-59480W Monoclonal Marmoset WB, ELISA MO59480W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO87665FYA
SpecificityThis antibody binds to Zebrafish mtfp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish mtfp1 Antibody is a mouse antibody against mtfp1. It can be used for mtfp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial fission process protein 1; Mitochondrial 18 kDa protein; MTP18; mtfp1; mtp1
UniProt IDQ6PCS6
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: MEPSADTHSKPVDIYRDTWVRFLGYANEVGEAFRALVPVGAVWASYGVATTYVTADAIDKGRKAAAAHGERPGKAVCVCVAVVDTFVWQALASVAVPGFTINRVCAASHFLLSRTTRWPLPVRKWTTTAIGLSTIPFIITPIDRSVDLLLDSSLRKLYSEGEKED.
For Research Use Only | Not For Clinical Use.
Online Inquiry