AibGenesis™ Mouse Anti-MTHFD2L Antibody (CBMOAB-51870FYA)


Cat: CBMOAB-51870FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51870FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO51870FYA 100 µg
CBMOAB-87692FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87692FYA 100 µg
MO-AB-05371H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05371C 100 µg
MO-AB-59490W Monoclonal Marmoset WB, ELISA MO59490W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO51870FYA
SpecificityThis antibody binds to Rhesus MTHFD2L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MTHFD2L Antibody is a mouse antibody against MTHFD2L. It can be used for MTHFD2L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2; MTHFD2L
UniProt IDH9EX69
Protein RefseqThe length of the protein is 347 amino acids long.
The sequence is show below: MTVPVRGLLLLRGRLGRVTALDRSTAPSVRAPGEPGSEFRGFQSSSVRHEAIIISGTEMAKRIQKEIQRGVESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGIYSELILKPKDVSQEELLDITDQLNMDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVRDPLTGKTKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKQIIY.
For Research Use Only | Not For Clinical Use.
Online Inquiry