AibGenesis™ Mouse Anti-MTMR4 Antibody (MO-AB-16175R)


Cat: MO-AB-16175R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-16175R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO16175R 100 µg
MO-AB-17583W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17583W 100 µg
MO-AB-59514W Monoclonal Marmoset WB, ELISA MO59514W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO16175R
SpecificityThis antibody binds to Cattle MTMR4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle MTMR4 Antibody is a mouse antibody against MTMR4. It can be used for MTMR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMTMR4 protein; MTMR4
UniProt IDA6QNR4
Protein RefseqThe length of the protein is 1127 amino acids long.
The sequence is show below: MGEEGPPSLEYIQAKDLFPHKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRLHIKFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTFKQCQEWLSRLSRATARPAKPEDLFAFAYHAWCLGLTEEDQHAHLCQPGEHVRCRQEAELARMGFDLQNVWRVSHINSNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISWWGWRNADDEYLVTSI.
For Research Use Only | Not For Clinical Use.
Online Inquiry