AibGenesis™ Mouse Anti-MVB12B Antibody (CBMOAB-51966FYA)


Cat: CBMOAB-51966FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51966FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO51966FYA 100 µg
CBMOAB-60332FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60332FYC 100 µg
MO-AB-22946W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22946W 100 µg
MO-AB-59563W Monoclonal Marmoset WB, ELISA MO59563W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO51966FYA
SpecificityThis antibody binds to Rhesus MVB12B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus MVB12B Antibody is a mouse antibody against MVB12B. It can be used for MVB12B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMVB12B
UniProt IDF6TFC5
Protein RefseqThe length of the protein is 345 amino acids long.
The sequence is show below: GSRSSCGAGSCRLGPGPGPSRAARAMRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVSQDTSLVWRASWFGNLFLASPLSYCWLTSSCLPQKSSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSSAASTPAPNLPRHISLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGITIKSLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQIPQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry