AibGenesis™ Mouse Anti-MXRA5 Antibody (CBMOAB-51981FYA)


Cat: CBMOAB-51981FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51981FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO51981FYA 100 µg
MO-AB-20051W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20051W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO51981FYA
SpecificityThis antibody binds to Rhesus MXRA5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of the matrix-remodelling associated proteins. This protein contains 7 leucine-rich repeats and 12 immunoglobulin-like C2-type domains related to perlecan. This gene has a pseudogene on chromosome Y. (From NCBI)
Product OverviewMouse Anti-Rhesus MXRA5 Antibody is a mouse antibody against MXRA5. It can be used for MXRA5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMatrix-remodeling-associated protein 5; MXRA5
UniProt IDH9FJ08
Protein RefseqThe length of the protein is 189 amino acids long.
The sequence is show below: GMREEGDYTCFAENQVGKDEMRVRVKVVTAPATIRNKTYLAVQVPYGDVATVACEAKGEPMPKVTWLSPTNRVIPTASEKYQIYQDGTLLIQKAQRSDSGNYTCLVRNSAGEDRKTVWIHVNVQPPKINGSPNPITTVREIAAGGSRKLIDCRAEGIPTPRVLWAFPEGVVLPAPYYGNRVTVHGNGSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry