AibGenesis™ Mouse Anti-MXRA7 Antibody (CBMOAB-51982FYA)


Cat: CBMOAB-51982FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51982FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO51982FYA 100 µg
CBMOAB-87886FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87886FYA 100 µg
MO-AB-04525W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04525W 100 µg
MO-AB-05388H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05388C 100 µg
MO-AB-15629W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15629W 100 µg
MO-AB-27325H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27325C 100 µg
MO-AB-59579W Monoclonal Marmoset WB, ELISA MO59579W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO51982FYA
SpecificityThis antibody binds to Rhesus MXRA7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMXRA7 (Matrix Remodeling Associated 7) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus MXRA7 Antibody is a mouse antibody against MXRA7. It can be used for MXRA7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMXRA7
UniProt IDF6YRI8
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: MDRLDLRGPRLSPLPSAPSPTTSHHPVCAKGTDPVLVLQKEEQDLDGETGPSSAEPEEDDGEGFSFKYSPGKLRGNQYKKMMTKEELEEEQRVQKEQLAAIFKLMKDNKETFGEMSDGDVQEQLRLYDM.
For Research Use Only | Not For Clinical Use.
Online Inquiry