AibGenesis™ Mouse Anti-myb29 Antibody (CBMOAB-34771FYB)


Cat: CBMOAB-34771FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34771FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), French-bean, Rice WB, ELISA MO34771FYB 100 µg
CBMOAB-36886FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO36886FC 100 µg
MO-AB-36317W Monoclonal French-bean WB, ELISA MO36317W 100 µg
MO-MMB-0280 Polyclonal Rice ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), French-bean, Rice
CloneMO34771FYB
SpecificityThis antibody binds to Rice myb29.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice myb29 Antibody is a mouse antibody against myb29. It can be used for myb29 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMYB29 protein; myb29
UniProt IDQ8GU99
Protein RefseqThe length of the protein is 107 amino acids long.
The sequence is show below: EAVEQENMLRPLRAMPDFAQVYSFLGSIFDPDTSGHLQTLKAMDPIDVETVLLLMRNLSMNLTSPNFAAHLSLLSSCNSGGDPIKSEGMENLGSPQSCHLPFMVTSE.
For Research Use Only | Not For Clinical Use.
Online Inquiry