AibGenesis™ Mouse Anti-MYB4 Antibody (CBMOAB-34774FYB)


Cat: CBMOAB-34774FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34774FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Maize (Zea mays), Rice WB, ELISA MO34774FYB 100 µg
Inquiry
CBMOAB-36908FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO36908FC 100 µg
Inquiry
MO-AB-48810W Monoclonal Maize (Zea mays) WB, ELISA MO48810W 100 µg
Inquiry
MO-MMB-0334 Polyclonal Rice ELISA, WB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Maize (Zea mays), Rice
CloneMO34774FYB
SpecificityThis antibody binds to Rice MYB4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice MYB4 Antibody is a mouse antibody against MYB4. It can be used for MYB4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyb-related protein Myb4; OsMyb4; Transcription factor RLTR1; MYB4; LTR1; Os04g0517100 LOC_Os04g43680
UniProt IDQ7XBH4
Protein RefseqThe length of the protein is 257 amino acids long.
The sequence is show below: MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEDTIIHLHELLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLDAPAQGGHVAASGGKKHKKPKSAKKPAAAAAAPPASPERSASSSVTESSMASSVAEEHGNAGISSASASVCAKEESSFTSASEEFQIDDSFWSETLSMPLDGYDVSMEPGDAFVAPPSADDMDYWLGVFMESGEAQDLPQI.
For Research Use Only | Not For Clinical Use.
Online Inquiry