AibGenesis™ Mouse Anti-MYL7 Antibody (CBMOAB-52043FYA)


Cat: CBMOAB-52043FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52043FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52043FYA 100 µg
CBMOAB-88073FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88073FYA 100 µg
MO-AB-27348H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27348C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52043FYA
SpecificityThis antibody binds to Rhesus MYL7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MYL7 Antibody is a mouse antibody against MYL7. It can be used for MYL7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMYL7
UniProt IDF6PLW4
Protein RefseqThe length of the protein is 174 amino acids long.
The sequence is show below: ASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKEEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry