AibGenesis™ Mouse Anti-MYOZ3 Antibody (CBMOAB-52109FYA)


Cat: CBMOAB-52109FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52109FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Sheep (Ovis aries) WB, ELISA MO52109FYA 100 µg
MO-AB-16241Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16241Y 100 µg
MO-AB-16336R Monoclonal Cattle (Bos taurus) WB, ELISA MO16336R 100 µg
MO-AB-37740W Monoclonal Goat (Capra hircus) WB, ELISA MO37740W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Sheep (Ovis aries)
CloneMO52109FYA
SpecificityThis antibody binds to Rhesus MYOZ3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is specifically expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. (From NCBI)
Product OverviewMouse Anti-Rhesus MYOZ3 Antibody is a mouse antibody against MYOZ3. It can be used for MYOZ3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMYOZ3
UniProt IDF6PL70
Protein RefseqThe length of the protein is 205 amino acids long.
The sequence is show below: MIPKEQKGPVMAAMGNFTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQKFTFELAASQRAMLAGSAKRKVTGTAESGTVANANGPEGQNYRSELHIFRASPGASLGGPEGAHSAAAPAGCVPSPSALAPGYVEPLKGVPPEKFNHTAIPKGYRCPWQEFVSYRDYQSDGRIFLPSFNRVAQGWVRNLPESEEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry