AibGenesis™ Mouse Anti-naa38 Antibody (CBMOAB-88255FYA)


Cat: CBMOAB-88255FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-88255FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO88255FYA 100 µg
MO-AB-04583W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04583W 100 µg
MO-AB-25646W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25646W 100 µg
MO-AB-27372H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27372C 100 µg
MO-AB-35160W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35160W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO88255FYA
SpecificityThis antibody binds to Zebrafish naa38.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish naa38 Antibody is a mouse antibody against naa38. It can be used for naa38 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesN-alpha-acetyltransferase 38, NatC auxiliary subunit; LSM domain-containing protein 1; naa38; lsmd
UniProt IDA2BIG9
Protein RefseqThe length of the protein is 109 amino acids long.
The sequence is show below: MASQREENSTQMQNEVVELAYSLARCKLENLLNKSMRIRMTDGRTLVGLFLCTDRDCNVILGSAQEFLKSTDSLSQGEPRVLGLAMIPGHHVVSIEVETESLQTTTHGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry