AibGenesis™ Mouse Anti-NCCRP1 Antibody (CBMOAB-52309FYA)


Cat: CBMOAB-52309FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52309FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO52309FYA 100 µg
CBMOAB-88459FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88459FYA 100 µg
MO-AB-59786W Monoclonal Marmoset WB, ELISA MO59786W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO52309FYA
SpecificityThis antibody binds to Rhesus NCCRP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NCCRP1 Antibody is a mouse antibody against NCCRP1. It can be used for NCCRP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNCCRP1
UniProt IDF6QWL0
Protein RefseqThe length of the protein is 275 amino acids long.
The sequence is show below: MEEVREGHALGGGMEADGPASPQELPPSPRSPSPPPSPPPLPSPPSLPSPAAPEAPELPEPEQPSEVHARQLLLEEWGPLSGGLELPPRLTWKLLLLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLLAEGLWEELLDDEQPDITVMDWFEDSRLDACVYELHVWLLAADRRSVIAQHHVAPRTSGRGPPGRWVQVSHVFRHYGPGVRFIHFLHKAKNRMEPGGLRRTRVTDSSVSVQLRE.
For Research Use Only | Not For Clinical Use.
Online Inquiry