AibGenesis™ Mouse Anti-ndhM Antibody (CBMOAB-34969FYB)


Cat: CBMOAB-34969FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34969FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO34969FYB 100 µg
CBMOAB-37246FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO37246FC 100 µg
MO-DKB-01959W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO34969FYB
SpecificityThis antibody binds to Rice ndhM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice ndhM Antibody is a mouse antibody against ndhM. It can be used for ndhM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNAD(P)H-quinone oxidoreductase subunit M, chloroplastic; EC 1.6.5.-; NAD(P)H dehydrogenase I subunit M; NDH-1 subunit M; NDH-M; ndhM; Os04g0539000 LOC_Os04g45600
UniProt IDQ7FB12
Protein RefseqThe length of the protein is 220 amino acids long.
The sequence is show below: MATTASPFLSPAKLSLERRLPRATWTARRSVRFPPVRAQDQQQQVKEEEEEAAVENLPPPPQEEEQRRERKTRRQGPAQPLPVQPLAESKNMSREYGGQWLSCTTRHIRIYAAYINPETNAFDQTQMDKLTLLLDPTDEFVWTDETCQKVYDEFQDLVDHYEGAELSEYTLRLIGSDLEHFIRKLLYDGEIKYNMMSRVLNFSMGKPRIKFNSSQIPDVK.
For Research Use Only | Not For Clinical Use.
Online Inquiry