AibGenesis™ Mouse Anti-ndufaf2 Antibody (CBMOAB-88629FYA)


Cat: CBMOAB-88629FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-88629FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO88629FYA 100 µg
MO-AB-05520H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05520C 100 µg
MO-AB-16597R Monoclonal Cattle (Bos taurus) WB, ELISA MO16597R 100 µg
MO-AB-18567W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18567W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO88629FYA
SpecificityThis antibody binds to Zebrafish ndufaf2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ndufaf2 Antibody is a mouse antibody against ndufaf2. It can be used for ndufaf2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNADH dehydrogenase (Ubiquinone) 1 alpha subcomplex 12, like; ndufaf2; ndufa12
UniProt IDQ6AXJ6
Protein RefseqThe length of the protein is 163 amino acids long.
The sequence is show below: MSRIASLLRRTFGVVKEHVGTDLSGNKYYNIPQQKTWTGRVVRPRRLVEVANPKEFEYMEGSIPSEWDAWIRGRRKQPPTIEELLKNKHGREQIKIKAAEVEEMDKALQVKEYEDGLVAESVQTQIKGHASAAQFGKTEFSEEPVSTANAFQPGSWTPAGTKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry