AibGenesis™ Mouse Anti-NEBL Antibody (CBMOAB-52426FYA)


Cat: CBMOAB-52426FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52426FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52426FYA 100 µg
CBMOAB-88680FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88680FYA 100 µg
MO-AB-05542H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05542C 100 µg
MO-AB-27449H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27449C 100 µg
MO-AB-59900W Monoclonal Marmoset WB, ELISA MO59900W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52426FYA
SpecificityThis antibody binds to Rhesus NEBL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nebulin like protein that is abundantly expressed in cardiac muscle. The encoded protein binds actin and interacts with thin filaments and Z-line associated proteins in striated muscle. This protein may be involved in cardiac myofibril assembly. A shorter isoform of this protein termed LIM nebulette is expressed in non-muscle cells and may function as a component of focal adhesion complexes. Alternate splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus NEBL Antibody is a mouse antibody against NEBL. It can be used for NEBL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNEBL
UniProt IDF7GXM0
Protein RefseqThe length of the protein is 265 amino acids long.
The sequence is show below: MELNSEVLDIQRAKRASEMASEKEYKKDLESIIKGKGMQAGSDTLEMQHAKKAAEIASEKDYKRDLETEIKGKGMQVSTDTLDVQRAKKASEMASQKQYKKDLENEIKGRGMQVSMDIPDILRAKRTSEIYSQRKYKDEAEKMLSNYSTIADTPEIRRIKTTQQNISVIFYKKEVGAGTAVKHTPEIERVKKNQQNISSVKYKEEIKHATAISDPPELKRVKENQKNISNLQYKEQNYKATPVSMTPEMERVRRNQEQLSAASKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry