Mouse Anti-NEK7 Antibody (MO-AB-14791W)
Cat: MO-AB-14791W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-14791W | Monoclonal | Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO14791W | 100 µg | ||
| CBMOAB-88738FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO88738FYA | 100 µg | ||
| MO-AB-05559H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05559C | 100 µg | ||
| MO-DKB-00818W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, IF, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO14791W |
| Specificity | This antibody binds to Chimpanzee NEK7. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Chimpanzee NEK7 Antibody is a mouse antibody against NEK7. It can be used for NEK7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | NIMA (Never in mitosis gene a)-related kinase 7; NEK7 |
| UniProt ID | H2Q0U7 |
| Protein Refseq | The length of the protein is 302 amino acids long. The sequence is show below: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS. |
See other products for " NEK7 "
| CBMOAB-37271FYC | Mouse Anti-NEK7 Antibody (CBMOAB-37271FYC) |
| MO-AB-59934W | Mouse Anti-NEK7 Antibody (MO-AB-59934W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry