AibGenesis™ Mouse Anti-NEK7 Antibody (MO-AB-59934W)


Cat: MO-AB-59934W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-59934W Monoclonal Marmoset, Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO59934W 100 µg
CBMOAB-88738FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88738FYA 100 µg
MO-AB-05559H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05559C 100 µg
MO-DKB-00818W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO59934W
SpecificityThis antibody binds to Marmoset NEK7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Marmoset NEK7 Antibody is a mouse antibody against NEK7. It can be used for NEK7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerine/threonine-protein kinase Nek7; NEK7
UniProt IDU3FJS7
Protein RefseqThe length of the protein is 302 amino acids long.
The sequence is show below: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS.
For Research Use Only | Not For Clinical Use.
Online Inquiry