AibGenesis™ Mouse Anti-NHP2 Antibody (CBMOAB-02589CR)
Cat: CBMOAB-02589CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-02589CR | Monoclonal | Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO02589CR | 100 µg | ||
| CBMOAB-25651FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO25651FYA | 100 µg | ||
| CBMOAB-88978FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO88978FYA | 100 µg | ||
| MO-AB-16736R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16736R | 100 µg | ||
| MO-AB-25407W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25407W | 100 µg | ||
| MO-AB-27481H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27481C | 100 µg | ||
| MO-AB-60057W | Monoclonal | Marmoset | WB, ELISA | MO60057W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO02589CR |
| Specificity | This antibody binds to Yeast NHP2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis (PubMed:9843512, PubMed:9848653). This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1 (PubMed:9843512, PubMed:9848653). Pseudouridine ('psi') residues may serve to stabilize the conformation of rRNAs (PubMed:9843512, PubMed:9848653). The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs (PubMed:21131909). The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA (PubMed:21131909). Essential for growth (PubMed:9843512). Directly binds H/ACA snoRNAs (PubMed:11433018). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast NHP2 Antibody is a mouse antibody against NHP2. It can be used for NHP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | H/ACA ribonucleoprotein complex subunit 2; H/ACA snoRNP protein NHP2; High mobility group-like nuclear protein 2; NHP2; YDL208W |
| UniProt ID | P32495 |
| Protein Refseq | The length of the protein is 156 amino acids long. The sequence is show below: MGKDNKEHKESKESKTVDNYEARMPAVLPFAKPLASKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry