AibGenesis™ Mouse Anti-NHP2L1 Antibody (MO-AB-25271W)


Cat: MO-AB-25271W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-25271W Monoclonal Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO25271W 100 µg
MO-AB-60058W Monoclonal Marmoset WB, ELISA MO60058W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset
CloneMO25271W
SpecificityThis antibody binds to Chimpanzee NHP2L1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee NHP2L1 Antibody is a mouse antibody against NHP2L1. It can be used for NHP2L1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNHP2 non-histone chromosome protein 2-like 1; NHP2L1
UniProt IDK7CG62
Protein RefseqThe length of the protein is 128 amino acids long.
The sequence is show below: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEAPKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry