Mouse Anti-Nile tilapia eif3g Antibody (MO-AB-33062H)


Cat: MO-AB-33062H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityNile tilapia (Oreochromis niloticus)
CloneMO33062C
SpecificityThis antibody binds to Nile tilapia eif3g.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a core subunit of the eukaryotic translation initiation factor 3 (eIF3) complex, which is required for initiation of protein translation. An N-terminal caspase cleavage product of the encoded protein may stimulate degradation of DNA. A mutation in this gene is associated with narcolepsy.
Product OverviewThis product is a mouse antibody against eif3g. It can be used for eif3g detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEukaryotic translation initiation factor 3 subunit G; eIF3g; Eukaryotic translation initiation factor 3 RNA-binding subunit; Eukaryotic translation initiation factor 3 subunit 4; LOC100694488
UniProt IDI3IZF4
Protein RefseqThe length of the protein is 296 amino acids long.
The sequence is show below: MPSIEYDDSKPSWADQVEEEGDEGTLPSPKETIKGNIKTVTEYKIDDDGKKYKIVRTFKIETRKASKAVARRKNWKKFGNSEYDAPGPNVATTTVSDDVFMTFISSKEDLNAQDQDEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGDKEKAAGSAEPEPAQPAQSKTGKYVPPSLRDGGTRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKNTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSNN.
For Research Use Only | Not For Clinical Use.
Online Inquiry