AibGenesis™ Mouse Anti-NIP7 Antibody (MO-AB-42140W)
Cat: MO-AB-42140W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-42140W | Monoclonal | Guinea pig (Cavia porcellus), Cattle (Bos taurus), Elephant (Loxodonta africana), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) | WB, ELISA | MO42140W | 100 µg | ||
| MO-AB-45785W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45785W | 100 µg | ||
| MO-AB-16745R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16745R | 100 µg | ||
| MO-AB-01033R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01033R | 100 µg | ||
| MO-AB-27486H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27486C | 100 µg | ||
| MO-AB-33488H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33488C | 100 µg | ||
| MO-AB-00894L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00894L | 100 µg | ||
| MO-AB-08954Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08954Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Guinea pig (Cavia porcellus), Cattle (Bos taurus), Elephant (Loxodonta africana), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) |
| Clone | MO42140W |
| Specificity | This antibody binds to Guinea pig NIP7. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytosol; Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Guinea pig NIP7 Antibody is a mouse antibody against NIP7. It can be used for NIP7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 60S ribosome subunit biogenesis protein NIP7 homolog; NIP7 |
| UniProt ID | H0V1I7 |
| Protein Refseq | The length of the protein is180 amino acids long. The sequence is show below: MRPLTEEETRVMFEKIAIIIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKMLKLAANIAGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTAQYQGVVVYSMADVPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYIRHEETLT. |
See other products for " NIP7 "
| CBMOAB-52653FYA | AibGenesis™ Mouse Anti-NIP7 Antibody (CBMOAB-52653FYA) |
| CBMOAB-02597CR | AibGenesis™ Mouse Anti-NIP7 Antibody (CBMOAB-02597CR) |
| MO-AB-22813W | AibGenesis™ Mouse Anti-NIP7 Antibody (MO-AB-22813W) |
| MO-AB-60077W | AibGenesis™ Mouse Anti-NIP7 Antibody (MO-AB-60077W) |
| CBMOAB-89023FYA | AibGenesis™ Mouse Anti-nip7 Antibody (CBMOAB-89023FYA) |
| MO-AB-16333Y | AibGenesis™ Mouse Anti-NIP7 Antibody (MO-AB-16333Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry