AibGenesis™ Mouse Anti-NIP7 Antibody (MO-AB-60077W)


Cat: MO-AB-60077W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-60077W Monoclonal Marmoset, Cattle (Bos taurus), Elephant (Loxodonta africana), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO60077W 100 µg
MO-AB-45785W Monoclonal Horse (Equus caballus) WB, ELISA MO45785W 100 µg
MO-AB-16745R Monoclonal Cattle (Bos taurus) WB, ELISA MO16745R 100 µg
MO-AB-01033R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01033R 100 µg
MO-AB-27486H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27486C 100 µg
MO-AB-33488H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33488C 100 µg
MO-AB-00894L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00894L 100 µg
MO-AB-08954Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08954Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Cattle (Bos taurus), Elephant (Loxodonta africana), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO60077W
SpecificityThis antibody binds to Marmoset NIP7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for proper 27S pre-rRNA processing and 60S ribosome subunit assembly. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Marmoset NIP7 Antibody is a mouse antibody against NIP7. It can be used for NIP7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names60S ribosome subunit biogenesis protein NIP7 homolog; NIP7
UniProt IDU3EQB5
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADVPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT.
For Research Use Only | Not For Clinical Use.
Online Inquiry