AibGenesis™ Mouse Anti-NIPSNAP3A Antibody (CBMOAB-52667FYA)


Cat: CBMOAB-52667FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52667FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52667FYA 100 µg
CBMOAB-89039FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89039FYA 100 µg
MO-AB-05636H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05636C 100 µg
MO-AB-16749R Monoclonal Cattle (Bos taurus) WB, ELISA MO16749R 100 µg
MO-AB-20406W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20406W 100 µg
MO-AB-27487H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27487C 100 µg
MO-AB-60084W Monoclonal Marmoset WB, ELISA MO60084W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52667FYA
SpecificityThis antibody binds to Rhesus NIPSNAP3A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NIPSNAP3A Antibody is a mouse antibody against NIPSNAP3A. It can be used for NIPSNAP3A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein NipSnap homolog 3A; NIPSNAP3A
UniProt IDH9FSM5
Protein RefseqThe length of the protein is 247 amino acids long.
The sequence is show below: MLVLRSGLTRALASRTLAPQVCSSFATGPRQYDGTFYEFRTYYLKPSKMNEFLENFKKNAHLRTAHSELVGYWSVEFGGRMNKVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKIEKPPKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry