AibGenesis™ Mouse Anti-nitr9 Antibody (CBMOAB-89347FYA)


Cat: CBMOAB-89347FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-89347FYA Monoclonal Zebrafish (Danio rerio), Medaka (Oryzias latipes) WB, ELISA MO89347FYA 100 µg
MO-AB-01054R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01054R 100 µg
MO-DKB-03903W Monoclonal Zebrafish (Danio rerio) IF, FC ms2109-074 100 µg
MO-DKB-03904W Monoclonal Zebrafish (Danio rerio) WB, IF ms2109-075 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Medaka (Oryzias latipes)
CloneMO89347FYA
SpecificityThis antibody binds to Zebrafish nitr9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish nitr9 Antibody is a mouse antibody against nitr9. It can be used for nitr9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNitr9; Novel immune-type receptor 9 long isoform; nitr
UniProt IDQ5YCY7
Protein RefseqThe length of the protein is 316 amino acids long.
The sequence is show below: MINFWIFGLFCLIGISSTHPNAPPVFVKLGESVNMSCIYQSQMARHFSWYKHEPGQNPMLISTIYKYDHTAQFFNTFGNDSRFSVLNENGVHLLTIRNVQFSDSATYYCGGAYSNVMEVVKGTRLIVQGLEKHTVVKQHDLIPPHSGDSVSLTCTVLNQKCVGNHSMYWLIIESQDYRPRIISTHGTPVDQCEWISDGDFRALRCVYSFSRKDFRLSNSATYSCTVTACGEKLDRNGSKLDIDADSTEEMMILVLLSIARTCLLLLVIVMVIIWYCVYSKRISKNVHYPSDVAFRNRQSPKKRRPGLMINSVSNQQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry