AibGenesis™ Mouse Anti-NKAIN3 Antibody (CBMOAB-52679FYA)


Cat: CBMOAB-52679FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52679FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO52679FYA 100 µg
MO-AB-27490H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27490C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO52679FYA
SpecificityThis antibody binds to Rhesus NKAIN3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NKAIN3 Antibody is a mouse antibody against NKAIN3. It can be used for NKAIN3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNKAIN3
UniProt IDF7E4Y2
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: ISALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPRYIMVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCIVDFQYLEVIHSAVQILLSLVGFVYACYVISISMEEEDT.
For Research Use Only | Not For Clinical Use.
Online Inquiry