AibGenesis™ Mouse Anti-NKAIN4 Antibody (CBMOAB-52682FYA)


Cat: CBMOAB-52682FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52682FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52682FYA 100 µg
CBMOAB-89357FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89357FYA 100 µg
MO-AB-27491H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27491C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52682FYA
SpecificityThis antibody binds to Rhesus NKAIN4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NKAIN4 Antibody is a mouse antibody against NKAIN4. It can be used for NKAIN4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNKAIN4
UniProt IDF7HHH6
Protein RefseqThe length of the protein is 208 amino acids long.
The sequence is show below: MGSCSGRCALIVLCTFQLVTALERQVFDFLGYQWVPILANFAHIVVIILGLFGTIQFRPRYVVVYTVWTAIWVTWNIFIICFYLEVGGLSQDSELLTFSLSQHRSWWHEHWPGCLHEEVPAAGLGAPHGQALVSGAICALEPSSVEALHSGLQILIALLGFVCGCYVVSVFTEEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQAYLPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry