AibGenesis™ Mouse Anti-Nmnat Antibody (CBMOAB-25753FYA)


Cat: CBMOAB-25753FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25753FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana) WB, ELISA MO25753FYA 100 µg
CBMOAB-37446FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO37446FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana)
CloneMO25753FYA
SpecificityThis antibody binds to fruit fly Nmnat.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Nmnat Antibody is a mouse antibody against Nmnat. It can be used for Nmnat detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAT03272p; Nicotinamide mononucleotide adenylytransferase, isoform A; EC 2.7.7.1; Nmnat
UniProt IDQ9VC03
Protein RefseqThe length of the protein is 389 amino acids long.
The sequence is show below: MIVKISWPKNNITSECFRRFGSFKRRSKSKKMSAFIEETKSLLPRIAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASALDRCAMVKLATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGGGGGDDGENTHLPGWLPRGLHDSRDPVHLKLLCGADLLESFAVPGLWAEADIEDIVANHGLVVITRAGSNPGKFIFDSDILTKYQSNITLITNWVPNEVSSTLIRRLLGRGQSVKYLLDDLVLEYIKRQRLFNFKSKYITDAVRPNHLLFNHAYTDNNKNANSYSIGDQLEQDMDESDTPSPQLQHTPTSRVFCCGEVPLRGSKVLRSGPGQAVQVITMQADEKEESQAKKQKISQVQL.
For Research Use Only | Not For Clinical Use.
Online Inquiry