AibGenesis™ Mouse Anti-Nol Antibody (CBMOAB-25787FYA)


Cat: CBMOAB-25787FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25787FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Rice (Oryza) WB, ELISA MO25787FYA 100 µg
CBMOAB-35003FYB Monoclonal Rice (Oryza) WB, ELISA MO35003FYB 100 µg
CBMOAB-37457FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO37457FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Rice (Oryza)
CloneMO25787FYA
SpecificityThis antibody binds to fruit fly Nol.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for chlorophyll b degradation. Chlorophyll b, chlorophyllide b, pheophorbide b and pheophytin b can be used as substrates. Belongs to the chlorophyll catabolic enzymes (CCEs). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Nol Antibody is a mouse antibody against Nol. It can be used for Nol detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNo optic lobe protein; nol
UniProt IDQ9U519
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: MRSQIIILFAIVAFVSSAWAVADPATPPATDPTTPPATDPTTPPATDPATTSPTTSTSPTTSTSPSATGSSTTAPTTAPTTVAPTSKKGSGKKKTVVHHKSKVHKPGRRRTIRHSRGGKRSDRKKRSRRN.
For Research Use Only | Not For Clinical Use.
Online Inquiry