AibGenesis™ Mouse Anti-nol7 Antibody (CBMOAB-89586FYA)


Cat: CBMOAB-89586FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-89586FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO89586FYA 100 µg
MO-AB-16836R Monoclonal Cattle (Bos taurus) WB, ELISA MO16836R 100 µg
MO-AB-26280W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26280W 100 µg
MO-AB-27526H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27526C 100 µg
MO-AB-27795R Monoclonal Pig (Sus scrofa) WB, ELISA MO27795R 100 µg
MO-AB-60180W Monoclonal Marmoset WB, ELISA MO60180W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO89586FYA
SpecificityThis antibody binds to Zebrafish nol7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene localizes to the nucleolus, where it maintains nucleolar structure and cell growth rates. The encoded protein also functions as a tumor suppressor and regulator of angiogenesis. The RB tumor suppressor gene recruits transcription factors to this gene and positively regulates its expression. Two transcript variants encoding the same protein have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish nol7 Antibody is a mouse antibody against nol7. It can be used for nol7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesnol7; Nucleolar Protein 7
UniProt IDF1QS46
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: LIWRAPYNVCAKISLSTFKKVEMSDLTQTQFESSDDELPEEVAFDASKQAALKSVKDALESAKREKNLLKEKRRKRQQLFQEQKKRKLLPEDLLEEFDTEPQKQTEVTNNNKDEEETNTSEAISKSLPENYTVMRLKDESASNSLQQSAVDFIQSRFYGPRTNRTTNTELLSLNKKRGVNKGAAVQFANKKWAVDMKANVAKTNKRFMHKVKLIPT.
For Research Use Only | Not For Clinical Use.
Online Inquiry