AibGenesis™ Mouse Anti-NOTO Antibody (CBMOAB-52858FYA)


Cat: CBMOAB-52858FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52858FYA Monoclonal Rhesus (Macaca mulatta), Medaka (Oryzias latipes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52858FYA 100 µg
CBMOAB-89670FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89670FYA 100 µg
MO-AB-01068R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01068R 100 µg
MO-AB-27532H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27532C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Medaka (Oryzias latipes), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52858FYA
SpecificityThis antibody binds to Rhesus NOTO.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription regulator acting downstream of both FOXA2 and Brachyury (T) during notochord development. Required for node morphogenesis. Is essential for cilia formation in the posterior notochord (PNC) and for left-right patterning; acts upstream of FOXJ1 and RFX3 in this process and is required for the expression of various components important for axonemal assembly and function. Plays a role in regulating axial versus paraxial cell fate. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus NOTO Antibody is a mouse antibody against NOTO. It can be used for NOTO detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNOTO
UniProt IDF7FKR4
Protein RefseqThe length of the protein is 243 amino acids long.
The sequence is show below: SPPPAPSGARVRSPSSGRPPAPRFPTGPDTPRAPRRFESPFSVEAILARPDPCTPAASQPSGSACAHPAFWTAPFLCAAPGLPWACPASWLPAYLSVGLYPVPGPRMAPVCGLRGFGVTGLELAHCSGLWAFPDWAPTEDLRDTERQQKRVRTMFNLEQLQELEKVFAKQHNLVGKKRAQLAARLKLTENQVRVWFQNRRVKYQKQQKLRAAVTSAEAASLDEPSSSSNASIQSDDAGSGVDG.
For Research Use Only | Not For Clinical Use.
Online Inquiry