AibGenesis™ Mouse Anti-NREP Antibody (MO-AB-02024W)
Cat: MO-AB-02024W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-02024W | Monoclonal | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO02024W | 100 µg | ||
| MO-AB-26452W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26452W | 100 µg | ||
| MO-AB-27562H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27562C | 100 µg | ||
| MO-AB-27869R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27869R | 100 µg | ||
| MO-AB-60333W | Monoclonal | Marmoset | WB, ELISA | MO60333W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) |
| Clone | MO02024W |
| Specificity | This antibody binds to Rhesus NREP. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | May have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration. May also have functions in cellular differentiation. Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis. Down-regulates the expression of TGFB1 and TGFB2 but not of TGFB3. May play a role in the regulation of alveolar generation. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Rhesus NREP Antibody is a mouse antibody against NREP. It can be used for NREP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Neuronal protein 3.1 isoform a; C5orf13 |
| UniProt ID | H9EWE5 |
| Protein Refseq | The length of the protein is 68 amino acids long. The sequence is show below: MVYYPERFVWVSQEPFPNKNMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry