AibGenesis™ Mouse Anti-NXPH4 Antibody (CBMOAB-53241FYA)


Cat: CBMOAB-53241FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53241FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo) WB, ELISA MO53241FYA 100 µg
MO-AB-08989W Monoclonal Cat (Felis catus) WB, ELISA MO08989W 100 µg
MO-AB-17070R Monoclonal Cattle (Bos taurus) WB, ELISA MO17070R 100 µg
MO-AB-22715W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22715W 100 µg
MO-AB-35208W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35208W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo)
CloneMO53241FYA
SpecificityThis antibody binds to Rhesus NXPH4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NXPH4 Antibody is a mouse antibody against NXPH4. It can be used for NXPH4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNeurexophilin; NXPH4
UniProt IDI2CYG2
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: MRLLPEWFLLLFGPWLLKKAVNAQIPESGRPQYLELRPAAAGAGAPGQQLPALRSSDSLGAGRAWSWAWPTNHTAALAQAGAAGALPAQRTKRKPSIKAARAKKIFGWGDFYFRVHTLKFSLLVTGKIVDHVNGTFSVYFRHNSSSLGNLSVSIVPPSKRVEFGGVWLPGPVPHPLQSTLALEGVLPGLGPPLGMAAAAAGPGSFGGALAGPLGGALGVPGAKESRAFNCHVEYEKTNRARKHRPCLYDPSQVCFTEHTQSQAAWLCAKPFKVICIFVSFLSFDYKLVQKVCPDYNFQSEHPYFG.
For Research Use Only | Not For Clinical Use.
Online Inquiry