Mouse Anti-OGG1 Antibody (MO-AB-17137R)


Cat: MO-AB-17137R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-17137R Monoclonal Cattle (Bos taurus), Arabidopsis (Arabidopsis lyrata), Fruit fly (Drosophila melanogaster) WB, ELISA MO17137R 100 µg
CBMOAB-26436FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO26436FYA 100 µg
MO-AB-00762H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00762C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Arabidopsis (Arabidopsis lyrata), Fruit fly (Drosophila melanogaster)
CloneMO17137R
SpecificityThis antibody binds to Cattle OGG1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial localization. Many alternative splice variants for this gene have been described, but the full-length nature for every variant has not been determined.
Product OverviewThis product is a mouse antibody against OGG1. It can be used for OGG1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names8-oxoguanine DNA glycosylase; OGG1
UniProt IDA1L536
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: MVERLCQTFGPRLIQLDDVTYHGFPSLQALAGPEVEAQLRNLGLGYRARFVSASARAILEERGGLPWLQQLRKAPYEEAHKALCTLPGVGTKVADCICLMALDKPQAVPVDVHVWQIAQRDYSWHPTTSQAKGPSPQANKELGNFFRNLWGPYAGWAQAVLFSADLRQLQQAQEPPAKRRKRCTGPEG.
For Research Use Only | Not For Clinical Use.
Online Inquiry