Mouse Anti-Ogg1 Antibody (MO-AB-27656H)
Cat: MO-AB-27656H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-27656H | Monoclonal | Rat (Rattus norvegicus), Arabidopsis (Arabidopsis lyrata), Fruit fly (Drosophila melanogaster) | WB, ELISA | MO27656C | 100 µg | ||
CBMOAB-26436FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO26436FYA | 100 µg | ||
MO-AB-00762H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00762C | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus), Arabidopsis (Arabidopsis lyrata), Fruit fly (Drosophila melanogaster) |
Clone | MO27656C |
Specificity | This antibody binds to Rat Ogg1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial localization. Many alternative splice variants for this gene have been described, but the full-length nature for every variant has not been determined. |
Product Overview | This product is a mouse antibody against Ogg1. It can be used for Ogg1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ogg1 protein; Ogg1 |
UniProt ID | B2RYK1 |
Protein Refseq | The length of the protein is 137 amino acids long. The sequence is show below: MLFSSSLSSSMRHRTLTSSPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGVLADQVWTLTQTEDQLYCTVYRGDKGQVGRPTLEELETLHKYFQLDVSLTQLYSHWASVDSHFQSVAQKFQGLWTSTRSA. |
See other products for " OGG1 "
MO-AB-17137R | Mouse Anti-OGG1 Antibody (MO-AB-17137R) |
CBMOAB-02723CR | Mouse Anti-OGG1 Antibody (CBMOAB-02723CR) |
CBMOAB-53345FYA | Mouse Anti-OGG1 Antibody (CBMOAB-53345FYA) |
MO-AB-21288W | Mouse Anti-OGG1 Antibody (MO-AB-21288W) |
CBMOAB-90515FYA | Mouse Anti-ogg1 Antibody (CBMOAB-90515FYA) |
CBMOAB-37801FYC | Mouse Anti-OGG1 Antibody (CBMOAB-37801FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry