AibGenesis™ Mouse Anti-OPN1LW Antibody (MO-AB-06669Y)
Cat: MO-AB-06669Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-06669Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Goat (Capra hircus), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO06669Y | 100 µg | ||
| MO-AB-09074Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09074Y | 100 µg | ||
| MO-AB-09258W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09258W | 100 µg | ||
| MO-AB-17172R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17172R | 100 µg | ||
| MO-AB-32264W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO32264W | 100 µg | ||
| MO-AB-37900W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37900W | 100 µg | ||
| MO-AB-45850W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45850W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | O. anatinus (Ornithorhynchus anatinus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Goat (Capra hircus), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus) |
| Clone | MO06669Y |
| Specificity | This antibody binds to O. anatinus OPN1LW. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Plasma membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called red cone photopigment or long-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. This gene and the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of partial, protanopic colorblindness. (From NCBI) |
| Product Overview | This product is a mouse antibody against OPN1LW. It can be used for OPN1LW detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Long wavelength sensitive; Long-wave-sensitive opsin; OPN1LW |
| UniProt ID | A4ZIT0 |
| Protein Refseq | The length of the protein is 364 amino acids long. The sequence is show below: MTPAWNSGVYAARRRFEDEEDTTRTSVFVYTNSNNTRDPFEGPNYHIAPRWAYNVTSLWMIFVVIASVFTNGLVLVATMKFKKLRHPLNWILVNLAVADLGETLIASTISVINQIFGYFILGHPMCVLEGYTVSLCGITGLWSLSIISWERWIVVCKPFGNVKFDAKLAMVGIVFSWVWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSDPGVQSYMIVLMSTCCILPLSIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVSRMVVVMILAYCFCWGPYTIFACFAAANPGYAFHPLAAALPAYFAKSATIYNPIIYVFMNRQFRNCIMQLFGKKVDDGSELSSTSRTEVSSVSSVSPA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry