AibGenesis™ Mouse Anti-OR1K1 Antibody (CBMOAB-53445FYA)


Cat: CBMOAB-53445FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53445FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo) WB, ELISA MO53445FYA 100 µg
MO-AB-00938L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00938L 100 µg
MO-AB-08167W Monoclonal Cat (Felis catus) WB, ELISA MO08167W 100 µg
MO-AB-17206R Monoclonal Cattle (Bos taurus) WB, ELISA MO17206R 100 µg
MO-AB-32463W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32463W 100 µg
MO-AB-35240W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35240W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo)
CloneMO53445FYA
SpecificityThis antibody binds to Rhesus OR1K1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR1K1 Antibody is a mouse antibody against OR1K1. It can be used for OR1K1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOR1K1
UniProt IDF7GMN5
Protein RefseqThe length of the protein is 276 amino acids long.
The sequence is show below: LFLGIYLLNALSNLSMVVLVRCDGALRSPMYYFLGHLSLVDVCFTTVTVPRLLAGLLHPGQAISFQACFAQMYFFVALGITESYLLAAMSYDRATAVCRPLRYGALMTPWRCAALVRASWAVSHLHSLLHTLLLSALSYPRAAPVRHFFCDMAVMLSVATSDTSAAETAIFSEGLAVVLAPLLLVFLSYARILVAVLRLRSAGGRRRVFSTCGAHLVAVALFFGSVLSVYFRPSSAYSARYDRLAGVVYAVITPTLNPFIYSLRNKEVKSALKRVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry