AibGenesis™ Mouse Anti-OR1N1 Antibody (CBMOAB-53447FYA)


Cat: CBMOAB-53447FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53447FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset WB, ELISA MO53447FYA 100 µg
MO-AB-07686W Monoclonal Cat (Felis catus) WB, ELISA MO07686W 100 µg
MO-AB-16416W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16416W 100 µg
MO-AB-17209R Monoclonal Cattle (Bos taurus) WB, ELISA MO17209R 100 µg
MO-AB-35242W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35242W 100 µg
MO-AB-45869W Monoclonal Horse (Equus caballus) WB, ELISA MO45869W 100 µg
MO-AB-60642W Monoclonal Marmoset WB, ELISA MO60642W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset
CloneMO53447FYA
SpecificityThis antibody binds to Rhesus OR1N1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR1N1 Antibody is a mouse antibody against OR1N1. It can be used for OR1N1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOR1N1
UniProt IDF6PX04
Protein RefseqThe length of the protein is 303 amino acids long.
The sequence is show below: MGLTQGVFSPTSELLEGGNQTSTFEFLLWGLSDQARQQHILFLLFLWMYAVTVAGNLLIVLAIGTDTHLHTPMYFFLASLSCTDIFFTSTTVPKALVNIQTQSTSISYAGCLAQLYFFLTFGDMDIFLLAVMAYDRYVAICHPLHYMMIMSLHRCAVLIIPDFFCDLGPLMKVSCFDTQVNELVLLFLGGTVILIPFMLVLVSYIQIVSAILRAPSAQGRRKAFSTCGSHLVVVALFFGTVIRVYLCPSSSSSSSVEEDTAAAVMYTVVTPLLNPFIYSLRNKDMKAAVVRLLKGRVSFSQGQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry