AibGenesis™ Mouse Anti-OR2A25 Antibody (MO-AB-08522W)


Cat: MO-AB-08522W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08522W Monoclonal Cat (Felis catus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus) WB, ELISA MO08522W 100 µg
MO-AB-32484W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32484W 100 µg
MO-AB-35246W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35246W 100 µg
MO-AB-38655W Monoclonal Gorilla WB, ELISA MO38655W 100 µg
MO-AB-42209W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42209W 100 µg
MO-AB-45872W Monoclonal Horse (Equus caballus) WB, ELISA MO45872W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus)
CloneMO08522W
SpecificityThis antibody binds to Cat OR2A25.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Cat OR2A25 Antibody is a mouse antibody against OR2A25. It can be used for OR2A25 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR2A25
UniProt IDM3X874
Protein RefseqThe length of the protein is 310 amino acids long.
The sequence is show below: MGRNKTSVTEFILLGFPLNSRIQMLLFGLFSLFYAFTLLGNGLILRLIWLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLVNSDKPISFAGCMTQTFLFLSFAHTECLLLVVMSYDRYVAICHPLRYSVIMSWRVCITLALTSWILGVLLALVHLVLLIPLPFCGPQKVNHFFCEIIAVLKLACADTHINETMVLAGAVSVLVGPFSSIVISYIYILCAILKIQSGEGRQKAFSTCSSHLCVVGLFYGTAIIMYVGPHNGNPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVKAALKRMLEKERTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry