AibGenesis™ Mouse Anti-OR2J3 Antibody (CBMOAB-53461FYA)


Cat: CBMOAB-53461FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53461FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Gorilla WB, ELISA MO53461FYA 100 µg
MO-AB-20736W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20736W 100 µg
MO-AB-38660W Monoclonal Gorilla WB, ELISA MO38660W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Gorilla
CloneMO53461FYA
SpecificityThis antibody binds to Rhesus OR2J3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a G-protein-coupled receptor (GPCR) that functions as an olfactory receptor. Olfactory receptors interact with odorant molecules in the nose to initiate a neuronal response that triggers the perception of a smell. The protein encoded by this gene responds to cis-3-hexen-1-ol, which is released by wounded plants, including cut grass. This gene is situated in a cluster of similar olfactory-receptor coding genes on chromosome 6. (From NCBI)
Product OverviewMouse Anti-Rhesus OR2J3 Antibody is a mouse antibody against OR2J3. It can be used for OR2J3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR2J3
UniProt IDF7CCD0
Protein RefseqThe length of the protein is 309 amino acids long.
The sequence is show below: FLFKFNASSEGYFILVGFSNWPHLEVVLFVVVLIFYLMTLIGNLFIIILSYLDSHLHTPMYFFLLNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTTECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWIPLCGHHQVDHFFCEVPALLRLSCVDTHVNELTLMITSSVFVLIPLILILTSYGAIVQAVLRMQSTTGLQRVFGTCGAHLMVVSLFFIPAMCIYLQPPSENSQDQGKFIALFYTVVTPSLNPLIYTLRNKDVRGAVKRLMGWE.
For Research Use Only | Not For Clinical Use.
Online Inquiry