AibGenesis™ Mouse Anti-OR6C4 Antibody (CBMOAB-53543FYA)


Cat: CBMOAB-53543FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53543FYA Monoclonal Rhesus (Macaca mulatta), Guinea pig (Cavia porcellus), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus) WB, ELISA MO53543FYA 100 µg
MO-AB-09203Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09203Y 100 µg
MO-AB-42243W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42243W 100 µg
MO-AB-45917W Monoclonal Horse (Equus caballus) WB, ELISA MO45917W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Guinea pig (Cavia porcellus), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus)
CloneMO53543FYA
SpecificityThis antibody binds to Rhesus OR6C4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR6C4 Antibody is a mouse antibody against OR6C4. It can be used for OR6C4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR6C4
UniProt IDF6S5B8
Protein RefseqThe length of the protein is 309 amino acids long.
The sequence is show below: MKNRTMFGEFILLGLTNQPELQVMIFIFLSLTYMLSVLGNLTIITLTLLDPHLQTPMYFFLRNFSFLEISFTSIFIPRFLTSMTTGNKVISFAGCLTQYFFAIFLGATEFYLLASMSYDRYVAICKPLHYITIMSSRVCIQLVFCSWLGGFLAILPPIILMSQVDFCVSNILNHYYCDYGPLMELACSDTRLLELMVILLAVVTLVVTLVLVTLSYIYIIRTILMIPSVQQRTKAFSTCSSHMIVISLSYGSCMFMYINPSAKEGGAFNKGIAVLITSVTPLLNPFIYTLRNQQVKQAFKDSVKKIVKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry