AibGenesis™ Mouse Anti-OR6C6 Antibody (CBMOAB-53544FYA)


Cat: CBMOAB-53544FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53544FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus) WB, ELISA MO53544FYA 100 µg
MO-AB-00995L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00995L 100 µg
MO-AB-09204Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09204Y 100 µg
MO-AB-19313W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19313W 100 µg
MO-AB-45918W Monoclonal Horse (Equus caballus) WB, ELISA MO45918W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus)
CloneMO53544FYA
SpecificityThis antibody binds to Rhesus OR6C6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR6C6 Antibody is a mouse antibody against OR6C6. It can be used for OR6C6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR6C6
UniProt IDF7HKY0
Protein RefseqThe length of the protein is 318 amino acids long.
The sequence is show below: MKNQSMDIVFTLLGLTNDPLLQIVIFLFLFCNYILSLMGNLTIILLTLLDPRLKTPMYFFLQNFSFLEISFTTVCIPRFLTSILTGDKTISYNACATQLFFFLLLGVTEFYLLAAMSYDRYIAICKPLHYPIIMSSKVCYELVFISWVTGFLIIFPPLVLGLKLDFCASKTIDHFLCDTSPILQISCSDTRFIELMAFILAVLTLIITLLLVIFSYTYIIKTILKFPSVQQQTKALSTCSSHMIVVSITYGSCIFMYMKPSAKERVTLTKGVAVLNTSVAPLLNPFIYTLRNQQVKEALKDMLQRFCYFLNKTKFGYK.
For Research Use Only | Not For Clinical Use.
Online Inquiry