AibGenesis™ Mouse Anti-OR6J1 Antibody (CBMOAB-53551FYA)


Cat: CBMOAB-53551FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53551FYA Monoclonal Rhesus (Macaca mulatta), Elephant (Loxodonta africana), Pig (Sus scrofa) WB, ELISA MO53551FYA 100 µg
MO-AB-00998L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00998L 100 µg
MO-AB-27973R Monoclonal Pig (Sus scrofa) WB, ELISA MO27973R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Elephant (Loxodonta africana), Pig (Sus scrofa)
CloneMO53551FYA
SpecificityThis antibody binds to Rhesus OR6J1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene is a segregating pseudogene, where some individuals have an allele that encodes a functional olfactory receptor, while other individuals have an allele encoding a protein that is predicted to be non-functional. (From NCBI)
Product OverviewMouse Anti-Rhesus OR6J1 Antibody is a mouse antibody against OR6J1. It can be used for OR6J1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR6J1
UniProt IDF7GPI0
Protein RefseqThe length of the protein is 319 amino acids long.
The sequence is show below: NWTAAVTEFVLLGFSLSREAELLFLVLLLLTFLLTLLGNLLIIFTVLSCSRLHTPMYFFLCNLSILDIVFTSVISPKVLANLGSGDKTISFAGCIIQCYFYFSLGTVEFLLLTVMSYDRYAAICSPLRYTAIMRPPVCIETVVFSWMGGFLSVLFPTILISQLPFCSSNIISHFFCDGGPLLALAYADTTAIELMNFMLSSMVILCCVVLVAYSSTYIMLTIVRIPSASGRKKALNTCASHLTIVIISSGITVCIFVTPSQKEYLEINKIPSVMSSVMIPFLNPFIYTLRNDAMQGVLRDMWVRRMRAVLRSRLSSNKD.
For Research Use Only | Not For Clinical Use.
Online Inquiry