Mouse Anti-OR7G2 Antibody (MO-AB-08335W)


Cat: MO-AB-08335W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08335W Monoclonal Cat (Felis catus), Rabbit (Oryctolagus cuniculus) WB, ELISA MO08335W 100 µg
Inquiry
MO-AB-09218Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09218Y 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Rabbit (Oryctolagus cuniculus)
CloneMO08335W
SpecificityThis antibody binds to Cat OR7G2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Cat OR7G2 Antibody is a mouse antibody against OR7G2. It can be used for OR7G2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor
UniProt IDM3WWR1
Protein RefseqThe length of the protein is 325 amino acids long.
The sequence is show below: MEPRNHTGVSEFLLLGLTDDPELQPFLFCLFLSMYLVTILGNLLIILAISSDSHLHTPMYFFLSNLSFTDICLSTTTIPKMLVNIQAQNQSITYRGCLTQVGFVLAFGGFENFLLAAMAYDRYVAICHPLRYTVIMNPQLCVLLILLSLFFSVVVALLHSLMVLRLSFCKDLEIPHFFCELAQVIKLACSDTLINNILIYFVASLFGGIPLSGIIFSYTQIVSSVLRVPSAGGKLKAFSTCGSHLSVVSLFYGTVVGVYISSVVTDSSKKTAVASVMYVVVPQMMNPFIYSLQNRDMKGALKRILKKGFEMIVRYSNFISDEIFS.
For Research Use Only | Not For Clinical Use.
Online Inquiry