AibGenesis™ Mouse Anti-OR9K2 Antibody (CBMOAB-53581FYA)


Cat: CBMOAB-53581FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53581FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO53581FYA 100 µg
MO-AB-09226Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09226Y 100 µg
MO-AB-17336R Monoclonal Cattle (Bos taurus) WB, ELISA MO17336R 100 µg
MO-AB-19834W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19834W 100 µg
MO-AB-38692W Monoclonal Gorilla WB, ELISA MO38692W 100 µg
MO-AB-42252W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42252W 100 µg
MO-AB-60736W Monoclonal Marmoset WB, ELISA MO60736W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO53581FYA
SpecificityThis antibody binds to Rhesus OR9K2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR9K2 Antibody is a mouse antibody against OR9K2. It can be used for OR9K2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR9K2
UniProt IDF7G071
Protein RefseqThe length of the protein is 335 amino acids long.
The sequence is show below: MLGSKPRVHLYILPCASQQVSTMGDRGASNHSEMTDFILAGFRVRPELHILLFLLFLFVYAMILLGNVGMMAIIMTDPRLNTPMYFFLGNLSFIDLFYSSVIAPKAIINFWSESKSISFAGCVAQLFLFALFIVTEGFLLAAMAYDRFIAICNPLLYSVQMSTRLCTQLVASSYFCGCISSVIQTSMTFTLSFCASRAVDHFYCDSRPLQRLSCSDLFIHRMISFSLSCIIILPTIIVITVSYMYIVSTVLKIHSTEGRKKAFSTCSSHLGVVSVLYGAVFFMYLTPDRFPELSKVASLCYSLVTPMLNPLIYSLRNKDVQEALKKLLEKKNISL.
For Research Use Only | Not For Clinical Use.
Online Inquiry