AibGenesis™ Mouse Anti-ORF123 Antibody (CBMOAB-41928FYB)


Cat: CBMOAB-41928FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41928FYB Monoclonal Rice (Oryza), Sugar beet (Beta vulgaris) WB, ELISA MO41928FYB 100 µg
MO-AB-30375H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30375C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Sugar beet (Beta vulgaris)
CloneMO41928FYB
SpecificityThis antibody binds to Rice ORF123.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice ORF123 Antibody is a mouse antibody against ORF123. It can be used for ORF123 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesORF123
UniProt IDQ35303
Protein RefseqThe length of the protein is 123 amino acids long.
The sequence is show below: MDQDLLSLYGQYQSTKVDHMDVEKALDFVMNWKHLFSISIYLVHIFVSCVLGRNSISKEKVLEDFFNLSLADSPRYLDLPPPRSKLSSPAPLAGPEASSPLTDSSDSVKMKVISQKIGLSKTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry